SCOPe 2.08: Domain d2imha1: 2imh A:2-223

Lineage for d2imha1 (2imh A:2-223)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.7: SPO2555-like [160846] (1 protein)
   Pfam PF06267; DUF1028

6. Protein Hypothetical protein SPO2555 [160847] (1 species)

7. Species Silicibacter pomeroyi [TaxId:89184] [160848] (1 PDB entry)
   Uniprot Q5LQD5 1-229

8. Domain d2imha1: 2imh A:2-223 [147724]
   Other proteins in same PDB: d2imha2, d2imha3, d2imhb2
   unprocessed precursor

Details for d2imha1

PDB Entry: 2imh, 1.57 Å

PDB Description: crystal structure of protein spo2555 from silicibacter pomeroyi, pfam duf1028

PDB Compounds: (A:) Hypothetical protein UNP Q5LQD5_SILPO

SCOPe Domain Sequences for d2imha1:

Sequence, based on SEQRES records:

>d2imha1 d.153.1.7 (A:2-223) Hypothetical protein SPO2555 {Silicibacter pomeroyi [TaxId: 89184]}
tfsilahdpetgaiggaaatgslcvggwvlrgdlnagmsasqgaapstfwgeevlqhlrd
gshpedavnhvtsqdsgrayrqlaamdllgnaaaftgsenqdikgsvtfasgiasgnmlg
dnsvlgamteafvasdltferrllaaliaaegagsdfrgllsaamlvlhpdrppvtlrid
yhpdnpigaleqlyqkattgdyadwarqvpvlsdkerildeg

Sequence, based on observed residues (ATOM records):

>d2imha1 d.153.1.7 (A:2-223) Hypothetical protein SPO2555 {Silicibacter pomeroyi [TaxId: 89184]}
tfsilahdpetgaiggaaatgslcvggwvlrgdlnagmsasqgaapstfwgeevlqhlrd
gshpedavnhvtsqdsgrayrqlaamdllgnaaaftgsenqdikgsvtfasgiasgnmlg
dnsvlgamteafvasdltferrllaaliaaegaggllsaamlvlhpdrppvtlridyhpd
npigaleqlyqkattgdyadwarqvpvlsdkerildeg

Timeline for d2imha1:

• d2imha1 first appeared in SCOP 1.75
  
• d2imha1 appears in SCOPe 2.07