SCOPe 2.08: Domain d2il5a1: 2il5 A:5-168

Lineage for d2il5a1 (2il5 A:5-168)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.5: AHSA1 domain [111168] (12 proteins)
   Pfam PF05146

6. Protein Hypothetical protein SA2116 [160736] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [160737] (1 PDB entry)
   Uniprot Q2FEH1 5-168

8. Domain d2il5a1: 2il5 A:5-168 [147723]
   complexed with na

Details for d2il5a1

PDB Entry: 2il5, 2.3 Å

PDB Description: Structure of Protein of Unknown Function SA2116 from Staphylococcus aureus

PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2il5a1:

Sequence, based on SEQRES records:

>d2il5a1 d.129.3.5 (A:5-168) Hypothetical protein SA2116 {Staphylococcus aureus [TaxId: 1280]}
nvenehveveieklykfspelvyeawtkkdllkqwfmtsartnkeieadvkeggkyrivd
qqrngkvnviegiyeslvmdeyvkmtigmpglsetqdvievefferetggtqmlfyyrsl
vekerrftnleykqkkkeyhdamvhgfelmfdkmyhvietstqq

Sequence, based on observed residues (ATOM records):

>d2il5a1 d.129.3.5 (A:5-168) Hypothetical protein SA2116 {Staphylococcus aureus [TaxId: 1280]}
nvenehveveieklykfspelvyeawtkkdllkqwfmtsartnkeieadvkeggkyrivd
qqrngkvnviegiyeslvmdeyvkmtigmpsetqdvievefferetggtqmlfyyrslve
kerrftnleykqkkkeyhdamvhgfelmfdkmyhvietstqq

Timeline for d2il5a1:

• d2il5a1 first appeared in SCOP 1.75
  
• d2il5a1 appears in SCOPe 2.07