SCOPe 2.02: Domain d2ikkb_: 2ikk B:

Lineage for d2ikkb_ (2ikk B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.190: Chorismate lyase-like [64287] (1 superfamily)
   duplication of alpha(2)-beta(3) motif; antiparallel beta sheet, order 123654

4. Superfamily d.190.1: Chorismate lyase-like [64288] (4 families)

5. Family d.190.1.2: UTRA domain [143473] (11 proteins)
   Pfam PF07702

6. Protein automated matches [190716] (1 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [187866] (1 PDB entry)

8. Domain d2ikkb_: 2ikk B: [147722]
   Other proteins in same PDB: d2ikka1
   automated match to d2ikka1
   complexed with so4

Details for d2ikkb_

PDB Entry: 2ikk, 1.8 Å

PDB Description: Structural Genomics, the crystal structure of the C-terminal domain of Yurk from Bacillus subtilis subsp. subtilis str. 168

PDB Compounds: (B:) Hypothetical transcriptional regulator yurK

SCOPe Domain Sequences for d2ikkb_:

Sequence, based on SEQRES records:

>d2ikkb_ d.190.1.2 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
tenlyfqsnastgkkpkhhvlshdiipaskpiaeklqiqpespvvelkrilynddqpltf
evthypldlfpgidtfiadgvsmhdilkqqykvvpthntkllnvvyaqqeeskyldcdig
dalfeidktaftsndqpiycslflmhtnrvtftins

Sequence, based on observed residues (ATOM records):

>d2ikkb_ d.190.1.2 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
tenlyfhhvlshdiipaskpiaeklqiqpespvvelkrilynddqpltfevthypldlfp
gidtfiadgvsmhdilkqqykvvpthntkllnvvyaqqeeskyldcdigdalfeidktaf
tsndqpiycslflmhtnrvtftins

Timeline for d2ikkb_:

• d2ikkb_ first appeared in SCOP 1.75, called d2ikkb1
  
• d2ikkb_ appears in SCOPe 2.01
  
• d2ikkb_ appears in SCOPe 2.03
  
• d2ikkb_ appears in the current release, SCOPe 2.08, called d2ikkb2