![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.190: Chorismate lyase-like [64287] (1 superfamily) duplication of alpha(2)-beta(3) motif; antiparallel beta sheet, order 123654 |
![]() | Superfamily d.190.1: Chorismate lyase-like [64288] (4 families) ![]() |
![]() | Family d.190.1.2: UTRA domain [143473] (11 proteins) Pfam PF07702 |
![]() | Protein automated matches [190716] (1 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [187866] (1 PDB entry) |
![]() | Domain d2ikkb_: 2ikk B: [147722] Other proteins in same PDB: d2ikka1 automated match to d2ikka1 complexed with so4 |
PDB Entry: 2ikk (more details), 1.8 Å
SCOPe Domain Sequences for d2ikkb_:
Sequence, based on SEQRES records: (download)
>d2ikkb_ d.190.1.2 (B:) automated matches {Bacillus subtilis [TaxId: 1423]} tenlyfqsnastgkkpkhhvlshdiipaskpiaeklqiqpespvvelkrilynddqpltf evthypldlfpgidtfiadgvsmhdilkqqykvvpthntkllnvvyaqqeeskyldcdig dalfeidktaftsndqpiycslflmhtnrvtftins
>d2ikkb_ d.190.1.2 (B:) automated matches {Bacillus subtilis [TaxId: 1423]} tenlyfhhvlshdiipaskpiaeklqiqpespvvelkrilynddqpltfevthypldlfp gidtfiadgvsmhdilkqqykvvpthntkllnvvyaqqeeskyldcdigdalfeidktaf tsndqpiycslflmhtnrvtftins
Timeline for d2ikkb_: