| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.190: Chorismate lyase-like [64287] (1 superfamily) duplication of alpha(2)-beta(3) motif; antiparallel beta sheet, order 123654 |
Superfamily d.190.1: Chorismate lyase-like [64288] (4 families) ![]() |
| Family d.190.1.2: UTRA domain [143473] (11 proteins) Pfam PF07702 |
| Protein automated matches [190716] (1 species) not a true protein |
| Species Bacillus subtilis [TaxId:1423] [187866] (1 PDB entry) |
| Domain d2ikkb2: 2ikk B:101-239 [147722] Other proteins in same PDB: d2ikka1, d2ikka2, d2ikkb3 automated match to d2ikka1 complexed with so4 |
PDB Entry: 2ikk (more details), 1.8 Å
SCOPe Domain Sequences for d2ikkb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ikkb2 d.190.1.2 (B:101-239) automated matches {Bacillus subtilis [TaxId: 1423]}
hhvlshdiipaskpiaeklqiqpespvvelkrilynddqpltfevthypldlfpgidtfi
adgvsmhdilkqqykvvpthntkllnvvyaqqeeskyldcdigdalfeidktaftsndqp
iycslflmhtnrvtftins
Timeline for d2ikkb2: