SCOPe 2.02: Domain d2ikka1: 2ikk A:86-238

Lineage for d2ikka1 (2ikk A:86-238)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.190: Chorismate lyase-like [64287] (1 superfamily)
   duplication of alpha(2)-beta(3) motif; antiparallel beta sheet, order 123654

4. Superfamily d.190.1: Chorismate lyase-like [64288] (4 families)

5. Family d.190.1.2: UTRA domain [143473] (11 proteins)
   Pfam PF07702

6. Protein Hypothetical transcriptional regulator YurK [160407] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [160408] (1 PDB entry)
   Uniprot O32152 86-238

8. Domain d2ikka1: 2ikk A:86-238 [147721]
   Other proteins in same PDB: d2ikkb_
   complexed with so4

Details for d2ikka1

PDB Entry: 2ikk, 1.8 Å

PDB Description: Structural Genomics, the crystal structure of the C-terminal domain of Yurk from Bacillus subtilis subsp. subtilis str. 168

PDB Compounds: (A:) Hypothetical transcriptional regulator yurK

SCOPe Domain Sequences for d2ikka1:

Sequence, based on SEQRES records:

>d2ikka1 d.190.1.2 (A:86-238) Hypothetical transcriptional regulator YurK {Bacillus subtilis [TaxId: 1423]}
nlyfqsnastgkkpkhhvlshdiipaskpiaeklqiqpespvvelkrilynddqpltfev
thypldlfpgidtfiadgvsmhdilkqqykvvpthntkllnvvyaqqeeskyldcdigda
lfeidktaftsndqpiycslflmhtnrvtftin

Sequence, based on observed residues (ATOM records):

>d2ikka1 d.190.1.2 (A:86-238) Hypothetical transcriptional regulator YurK {Bacillus subtilis [TaxId: 1423]}
nlyfqhhvlshdiipaskpiaeklqiqpespvvelkrilynddqpltfevthypldlfpg
idtfiadgvsmhdilkqqykvvpthntkllnvvyaqqeeskyldcdigdalfeidktaft
sndqpiycslflmhtnrvtftin

Timeline for d2ikka1:

• d2ikka1 first appeared in SCOP 1.75
  
• d2ikka1 appears in SCOPe 2.01
  
• d2ikka1 appears in SCOPe 2.03
  
• d2ikka1 appears in the current release, SCOPe 2.08