Lineage for d2ijmb_ (2ijm B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1671838Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1672980Protein Focal adhesion kinase 1 (fak) [103292] (2 species)
    PTK group; FAK subfamily; non-membrane spanning protein tyrosine kinase
  7. 1672984Species Human (Homo sapiens) [TaxId:9606] [103293] (15 PDB entries)
  8. 1672997Domain d2ijmb_: 2ijm B: [147715]
    automated match to d1mp8a_
    complexed with adp, atp

Details for d2ijmb_

PDB Entry: 2ijm (more details), 2.19 Å

PDB Description: crystal structure of focal adhesion kinase domain with 2 molecules in the asymmetric unit complexed with adp and atp
PDB Compounds: (B:) Focal adhesion kinase 1

SCOPe Domain Sequences for d2ijmb_:

Sequence, based on SEQRES records: (download)

>d2ijmb_ d.144.1.7 (B:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]}
dyeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvrekflqeal
tmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayqlsta
layleskrfvhrdiaarnvlvssndcvklgdfglsrymedstyykaskgklpikwmapes
infrrftsasdvwmfgvcmweilmhgvkpfqgvknndvigriengerlpmppncpptlys
lmtkcwaydpsrrprftelkaqlstileeekaqqee

Sequence, based on observed residues (ATOM records): (download)

>d2ijmb_ d.144.1.7 (B:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]}
dyeiqrerielgrcigegqfgdvhqgiymspenpalavaiktcknctsdsvrekflqeal
tmrqfdhphivkligvitenpvwiimelctlgelrsflqvrkysldlaslilyayqlsta
layleskrfvhrdiaarnvlvssndcvklgdfglslpikwmapesinfrrftsasdvwmf
gvcmweilmhgvkpfqgvknndvigriengerlpmppncpptlyslmtkcwaydpsrrpr
ftelkaqlstileeekaqqee

SCOPe Domain Coordinates for d2ijmb_:

Click to download the PDB-style file with coordinates for d2ijmb_.
(The format of our PDB-style files is described here.)

Timeline for d2ijmb_: