Lineage for d2iiqb2 (2iiq B:26-412)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910507Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2910508Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2910964Family c.87.1.9: Sialyltransferase-like [142773] (2 proteins)
    automatically mapped to Pfam PF11477
  6. 2910965Protein Alpha-2,3/2,6-sialyltransferase/sialidase [142774] (1 species)
  7. 2910966Species Pasteurella multocida [TaxId:747] [142775] (12 PDB entries)
    Uniprot Q15KI8 26-412
  8. 2910977Domain d2iiqb2: 2iiq B:26-412 [147711]
    Other proteins in same PDB: d2iiqa3, d2iiqb3
    automated match to d2ex0a1
    complexed with c5p

Details for d2iiqb2

PDB Entry: 2iiq (more details), 2.3 Å

PDB Description: Crystal structure of Pasteurella multocida sialyltransferase in an open conformation with CMP bound
PDB Compounds: (B:) alpha-2,3/2,6-sialyltransferase/sialidase

SCOPe Domain Sequences for d2iiqb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iiqb2 c.87.1.9 (B:26-412) Alpha-2,3/2,6-sialyltransferase/sialidase {Pasteurella multocida [TaxId: 747]}
ktitlyldpaslpalnqlmdftqnnedkthprifglsrfkipdniitqyqnihfvelkdn
rptealftildqypgnielnihlniahsvqlirpilayrfkhldrvsiqqlnlyddgsme
yvdlekeenkdisaeikqaekqlshylltgkikfdnptiaryvwqsafpvkyhflstdyf
ekaeflqplkeylaenyqkmdwtayqqltpeqqafyltlvgfndevkqslevqqakfift
gtttwegntdvreyyaqqqlnllnhftqaegdlfigdhykiyfkghprggeindyilnna
knitnipanisfevlmmtgllpdkvggvasslyfslpkekishiiftsnkqvkskedaln
npyvkvmrrlgiidesqvifwdslkql

SCOPe Domain Coordinates for d2iiqb2:

Click to download the PDB-style file with coordinates for d2iiqb2.
(The format of our PDB-style files is described here.)

Timeline for d2iiqb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2iiqb3