Lineage for d2iiqa2 (2iiq A:26-412)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142456Family c.87.1.9: Sialyltransferase-like [142773] (2 protein domains)
    automatically mapped to Pfam PF11477
  6. 2142457Protein Alpha-2,3/2,6-sialyltransferase/sialidase [142774] (1 species)
  7. 2142458Species Pasteurella multocida [TaxId:747] [142775] (12 PDB entries)
    Uniprot Q15KI8 26-412
  8. 2142469Domain d2iiqa2: 2iiq A:26-412 [147710]
    Other proteins in same PDB: d2iiqa3, d2iiqb3
    automated match to d2ex0a1
    complexed with c5p

Details for d2iiqa2

PDB Entry: 2iiq (more details), 2.3 Å

PDB Description: Crystal structure of Pasteurella multocida sialyltransferase in an open conformation with CMP bound
PDB Compounds: (A:) alpha-2,3/2,6-sialyltransferase/sialidase

SCOPe Domain Sequences for d2iiqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iiqa2 c.87.1.9 (A:26-412) Alpha-2,3/2,6-sialyltransferase/sialidase {Pasteurella multocida [TaxId: 747]}
ktitlyldpaslpalnqlmdftqnnedkthprifglsrfkipdniitqyqnihfvelkdn
rptealftildqypgnielnihlniahsvqlirpilayrfkhldrvsiqqlnlyddgsme
yvdlekeenkdisaeikqaekqlshylltgkikfdnptiaryvwqsafpvkyhflstdyf
ekaeflqplkeylaenyqkmdwtayqqltpeqqafyltlvgfndevkqslevqqakfift
gtttwegntdvreyyaqqqlnllnhftqaegdlfigdhykiyfkghprggeindyilnna
knitnipanisfevlmmtgllpdkvggvasslyfslpkekishiiftsnkqvkskedaln
npyvkvmrrlgiidesqvifwdslkql

SCOPe Domain Coordinates for d2iiqa2:

Click to download the PDB-style file with coordinates for d2iiqa2.
(The format of our PDB-style files is described here.)

Timeline for d2iiqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2iiqa3