SCOPe 2.05: Domain d2iija1: 2iij A:1-156

Lineage for d2iija1 (2iij A:1-156)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.22: ASF1-like [101546] (1 family)
   contains extra C-terminal strand
   automatically mapped to Pfam PF04729

5. Family b.1.22.1: ASF1-like [101547] (2 proteins)

6. Protein Anti-silencing protein 1, ASF1 [101548] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158910] (4 PDB entries)
   Uniprot Q6IA08 1-154! Uniprot Q9Y294 1-154! Uniprot Q9Y294 1-156

8. Domain d2iija1: 2iij A:1-156 [147709]

Details for d2iija1

PDB Entry: 2iij

PDB Description: structure of human asf1a in complex with histone h3

PDB Compounds: (A:) ASF1A protein

SCOPe Domain Sequences for d2iija1:

Sequence; same for both SEQRES and ATOM records:

>d2iija1 b.1.22.1 (A:1-156) Anti-silencing protein 1, ASF1 {Human (Homo sapiens) [TaxId: 9606]}
makvqvnnvvvldnpspfynpfqfeitfeciedlsedlewkiiyvgsaeseeydqvldsv
lvgpvpagrhmfvfqadapnpglipdadavgvtvvlitctyrgqefirvgyyvnneytet
elrenppvkpdfsklqrnilasnprvtrfhinwedn

Timeline for d2iija1:

• d2iija1 first appeared in SCOP 1.75
  
• d2iija1 appears in SCOPe 2.04
  
• d2iija1 appears in SCOPe 2.06
  
• d2iija1 appears in the current release, SCOPe 2.08