Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology automatically mapped to Pfam PF02776 |
Protein Carboxyethylarginine synthase [102330] (1 species) |
Species Streptomyces clavuligerus [TaxId:1901] [102331] (6 PDB entries) |
Domain d2ihvd2: 2ihv D:11-197 [147707] Other proteins in same PDB: d2ihva1, d2ihva3, d2ihvb1, d2ihvb3, d2ihvc2, d2ihvc3, d2ihvd1, d2ihvd3 automated match to d1upaa2 complexed with gva, k, mg, tpp |
PDB Entry: 2ihv (more details), 2.3 Å
SCOPe Domain Sequences for d2ihvd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ihvd2 c.36.1.5 (D:11-197) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} kptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlari tgrpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaiva pmskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidttvpnppant pakpvgv
Timeline for d2ihvd2: