Lineage for d2ihvb2 (2ihv B:12-197)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162387Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1162388Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 1162389Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
  6. 1162442Protein Carboxyethylarginine synthase [102330] (1 species)
  7. 1162443Species Streptomyces clavuligerus [TaxId:1901] [102331] (6 PDB entries)
  8. 1162450Domain d2ihvb2: 2ihv B:12-197 [147704]
    Other proteins in same PDB: d2ihva1, d2ihva3, d2ihvb1, d2ihvb3, d2ihvd1, d2ihvd3
    automatically matched to d1upaa2
    complexed with gva, k, mg, tpp

Details for d2ihvb2

PDB Entry: 2ihv (more details), 2.3 Å

PDB Description: carboxyethylarginine synthase from streptomyces clavuligerus: 5- guanidinovaleric acid complex
PDB Compounds: (B:) carboxyethylarginine synthase

SCOPe Domain Sequences for d2ihvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ihvb2 c.36.1.5 (B:12-197) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]}
ptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlarit
grpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaivap
mskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidttvpnppantp
akpvgv

SCOPe Domain Coordinates for d2ihvb2:

Click to download the PDB-style file with coordinates for d2ihvb2.
(The format of our PDB-style files is described here.)

Timeline for d2ihvb2: