SCOP 1.75: Domain d2ihua2: 2ihu A:12-197

Lineage for d2ihua2 (2ihu A:12-197)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins)
   the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology

6. Protein Carboxyethylarginine synthase [102330] (1 species)

7. Species Streptomyces clavuligerus [TaxId:1901] [102331] (6 PDB entries)

8. Domain d2ihua2: 2ihu A:12-197 [147698]
   Other proteins in same PDB: d2ihua1, d2ihua3
   automatically matched to d1upaa2
   complexed with gol, k, mg, tar, tp8, tp9

Details for d2ihua2

PDB Entry: 2ihu, 2.05 Å

PDB Description: Carboxyethylarginine synthase from Streptomyces clavuligerus: putative reaction intermediate complex

PDB Compounds: (A:) carboxyethylarginine synthase

SCOP Domain Sequences for d2ihua2:

Sequence; same for both SEQRES and ATOM records:

>d2ihua2 c.36.1.5 (A:12-197) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]}
ptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlarit
grpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaivap
mskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidttvpnppantp
akpvgv

Timeline for d2ihua2:

• d2ihua2 is new in SCOP 1.75
  
• d2ihua2 appears in SCOPe 2.01
  
• d2ihua2 appears in the current release, SCOPe 2.08