Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) binds cofactor molecules in the opposite direction than classical Rossmann fold |
Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins) N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold |
Protein Carboxyethylarginine synthase [102290] (1 species) |
Species Streptomyces clavuligerus [TaxId:1901] [102291] (6 PDB entries) |
Domain d2ihua1: 2ihu A:198-374 [147697] Other proteins in same PDB: d2ihua2, d2ihua3, d2ihub1, d2ihub3, d2ihuc1, d2ihuc3, d2ihud1, d2ihud3 automated match to d1upaa1 complexed with gol, k, mg, tar, tp8, tp9 |
PDB Entry: 2ihu (more details), 2.05 Å
SCOPe Domain Sequences for d2ihua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ihua1 c.31.1.3 (A:198-374) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} vadgwqkaadqaaallaeakhpvlvvgaaairsgavpairalaerlnipvittyiakgvl pvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyaedlrpsmwqkgiekktvr isptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhdieplrariaeflad
Timeline for d2ihua1: