| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
| Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins) N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold |
| Protein Carboxyethylarginine synthase [102290] (1 species) |
| Species Streptomyces clavuligerus [TaxId:1901] [102291] (6 PDB entries) |
| Domain d2ihtd1: 2iht D:198-374 [147694] Other proteins in same PDB: d2ihta2, d2ihta3, d2ihtb2, d2ihtb3, d2ihtc2, d2ihtc3, d2ihtd2, d2ihtd3 automatically matched to d1upaa1 complexed with gol, mg, so4, tpp |
PDB Entry: 2iht (more details), 2 Å
SCOPe Domain Sequences for d2ihtd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ihtd1 c.31.1.3 (D:198-374) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]}
vadgwqkaadqaaallaeakhpvlvvgaaairsgavpairalaerlnipvittyiakgvl
pvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyaedlrpsmwqkgiekktvr
isptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhdieplrariaeflad
Timeline for d2ihtd1: