Lineage for d2ihtc2 (2iht C:12-197)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 828800Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 828801Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 828802Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
  6. 828855Protein Carboxyethylarginine synthase [102330] (1 species)
  7. 828856Species Streptomyces clavuligerus [TaxId:1901] [102331] (6 PDB entries)
  8. 828859Domain d2ihtc2: 2iht C:12-197 [147692]
    Other proteins in same PDB: d2ihta1, d2ihta3, d2ihtb1, d2ihtb3, d2ihtc1, d2ihtc3, d2ihtd1, d2ihtd3
    automatically matched to d1upaa2
    complexed with gol, mg, so4, tpp

Details for d2ihtc2

PDB Entry: 2iht (more details), 2 Å

PDB Description: Carboxyethylarginine synthase from Streptomyces clavuligerus: SeMet structure
PDB Compounds: (C:) carboxyethylarginine synthase

SCOP Domain Sequences for d2ihtc2:

Sequence, based on SEQRES records: (download)

>d2ihtc2 c.36.1.5 (C:12-197) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]}
ptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlarit
grpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaivap
mskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidttvpnppantp
akpvgv

Sequence, based on observed residues (ATOM records): (download)

>d2ihtc2 c.36.1.5 (C:12-197) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]}
ptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlarit
grpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaivap
mskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidnppantpakpv
gv

SCOP Domain Coordinates for d2ihtc2:

Click to download the PDB-style file with coordinates for d2ihtc2.
(The format of our PDB-style files is described here.)

Timeline for d2ihtc2: