SCOPe 2.08: Domain d2ihtb2: 2iht B:11-197

Lineage for d2ihtb2 (2iht B:11-197)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins)
   the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
   automatically mapped to Pfam PF02776

6. Protein Carboxyethylarginine synthase [102330] (1 species)

7. Species Streptomyces clavuligerus [TaxId:1901] [102331] (6 PDB entries)

8. Domain d2ihtb2: 2iht B:11-197 [147689]
   Other proteins in same PDB: d2ihta1, d2ihta3, d2ihtb1, d2ihtb3, d2ihtc1, d2ihtc3, d2ihtd1, d2ihtd3
   automated match to d1upaa2
   complexed with gol, mg, so4, tpp

Details for d2ihtb2

PDB Entry: 2iht, 2 Å

PDB Description: Carboxyethylarginine synthase from Streptomyces clavuligerus: SeMet structure

PDB Compounds: (B:) carboxyethylarginine synthase

SCOPe Domain Sequences for d2ihtb2:

Sequence, based on SEQRES records:

>d2ihtb2 c.36.1.5 (B:11-197) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]}
kptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlari
tgrpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaiva
pmskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidttvpnppant
pakpvgv

Sequence, based on observed residues (ATOM records):

>d2ihtb2 c.36.1.5 (B:11-197) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]}
kptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlari
tgrpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaiva
pmskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidtpnppantpa
kpvgv

Timeline for d2ihtb2:

• d2ihtb2 first appeared in SCOP 1.75
  
• d2ihtb2 appears in SCOPe 2.07