| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
| Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology automatically mapped to Pfam PF02776 |
| Protein Carboxyethylarginine synthase [102330] (1 species) |
| Species Streptomyces clavuligerus [TaxId:1901] [102331] (6 PDB entries) |
| Domain d2ihtb2: 2iht B:11-197 [147689] Other proteins in same PDB: d2ihta1, d2ihta3, d2ihtb1, d2ihtb3, d2ihtc1, d2ihtc3, d2ihtd1, d2ihtd3 automated match to d1upaa2 complexed with gol, mg, so4, tpp |
PDB Entry: 2iht (more details), 2 Å
SCOPe Domain Sequences for d2ihtb2:
Sequence, based on SEQRES records: (download)
>d2ihtb2 c.36.1.5 (B:11-197) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]}
kptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlari
tgrpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaiva
pmskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidttvpnppant
pakpvgv
>d2ihtb2 c.36.1.5 (B:11-197) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]}
kptaahallsrlrdhgvgkvfgvvgreaasilfdevegidfvltrheftagvaadvlari
tgrpqacwatlgpgmtnlstgiatsvldrspvialaaqseshdifpndthqcldsvaiva
pmskyavelqrpheitdlvdsavnaamtepvgpsfislpvdllgssegidtpnppantpa
kpvgv
Timeline for d2ihtb2: