Lineage for d2ihtb1 (2iht B:198-374)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1360793Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 1360794Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 1360823Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins)
    N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold
  6. 1360877Protein Carboxyethylarginine synthase [102290] (1 species)
  7. 1360878Species Streptomyces clavuligerus [TaxId:1901] [102291] (6 PDB entries)
  8. 1360880Domain d2ihtb1: 2iht B:198-374 [147688]
    Other proteins in same PDB: d2ihta2, d2ihta3, d2ihtb2, d2ihtb3, d2ihtc2, d2ihtc3, d2ihtd2, d2ihtd3
    automated match to d1upaa1
    complexed with gol, mg, so4, tpp

Details for d2ihtb1

PDB Entry: 2iht (more details), 2 Å

PDB Description: Carboxyethylarginine synthase from Streptomyces clavuligerus: SeMet structure
PDB Compounds: (B:) carboxyethylarginine synthase

SCOPe Domain Sequences for d2ihtb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ihtb1 c.31.1.3 (B:198-374) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]}
vadgwqkaadqaaallaeakhpvlvvgaaairsgavpairalaerlnipvittyiakgvl
pvghelnygavtgymdgilnfpalqtmfapvdlvltvgydyaedlrpsmwqkgiekktvr
isptvnpiprvyrpdvdvvtdvlafvehfetatasfgakqrhdieplrariaeflad

SCOPe Domain Coordinates for d2ihtb1:

Click to download the PDB-style file with coordinates for d2ihtb1.
(The format of our PDB-style files is described here.)

Timeline for d2ihtb1: