Lineage for d2ihsa1 (2ihs A:31-234)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 794080Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 794081Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 795298Family b.29.1.22: SPRY domain [141154] (5 protein domains)
    Pfam PF00622
  6. 795303Protein Cg2944-PF (gus) [158989] (1 species)
    isoform F
  7. 795304Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [158990] (1 PDB entry)
    Uniprot A1Z6E2 31-234
  8. 795305Domain d2ihsa1: 2ihs A:31-234 [147683]

Details for d2ihsa1

PDB Entry: 2ihs (more details), 2.2 Å

PDB Description: Crystal structure of the B30.2/SPRY domain of GUSTAVUS in complex with a 20-residue VASA peptide
PDB Compounds: (A:) CG2944-PF, isoform F

SCOP Domain Sequences for d2ihsa1:

Sequence, based on SEQRES records: (download)

>d2ihsa1 b.29.1.22 (A:31-234) Cg2944-PF (gus) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
lqadfvkparidilldmppasrdlqlkhswnsedrslnifvkeddkltfhrhpvaqstdc
irgkvgltkglhiweiywptrqrgthavvgvctadaplhsvgyqslvgsteqswgwdlgr
nklyhdskncagvtypailkndeaflvpdkflvaldmdegtlsfivdqqylgiafrglrg
kklypivsavwghceitmryiggl

Sequence, based on observed residues (ATOM records): (download)

>d2ihsa1 b.29.1.22 (A:31-234) Cg2944-PF (gus) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
lqadfvkparidilldmppasrdlqlkhswnsedrslnifvkeddkltfhrhpvaqstdc
irgkvgltkglhiweiywptrqrgthavvgvctadaplhsvgyqslvgsteqswgwdlgr
nklyhdskncagvtypailknflvpdkflvaldmdegtlsfivdqqylgiafrglrgkkl
ypivsavwghceitmryiggl

SCOP Domain Coordinates for d2ihsa1:

Click to download the PDB-style file with coordinates for d2ihsa1.
(The format of our PDB-style files is described here.)

Timeline for d2ihsa1: