Lineage for d2ihsa1 (2ihs A:31-234)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2044039Family b.29.1.22: SPRY domain [141154] (6 protein domains)
    Pfam PF00622
  6. 2044044Protein Cg2944-PF (gus) [158989] (1 species)
    isoform F
  7. 2044045Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [158990] (1 PDB entry)
    Uniprot A1Z6E2 31-234
  8. 2044046Domain d2ihsa1: 2ihs A:31-234 [147683]
    Other proteins in same PDB: d2ihsa2

Details for d2ihsa1

PDB Entry: 2ihs (more details), 2.2 Å

PDB Description: Crystal structure of the B30.2/SPRY domain of GUSTAVUS in complex with a 20-residue VASA peptide
PDB Compounds: (A:) CG2944-PF, isoform F

SCOPe Domain Sequences for d2ihsa1:

Sequence, based on SEQRES records: (download)

>d2ihsa1 b.29.1.22 (A:31-234) Cg2944-PF (gus) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
lqadfvkparidilldmppasrdlqlkhswnsedrslnifvkeddkltfhrhpvaqstdc
irgkvgltkglhiweiywptrqrgthavvgvctadaplhsvgyqslvgsteqswgwdlgr
nklyhdskncagvtypailkndeaflvpdkflvaldmdegtlsfivdqqylgiafrglrg
kklypivsavwghceitmryiggl

Sequence, based on observed residues (ATOM records): (download)

>d2ihsa1 b.29.1.22 (A:31-234) Cg2944-PF (gus) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
lqadfvkparidilldmppasrdlqlkhswnsedrslnifvkeddkltfhrhpvaqstdc
irgkvgltkglhiweiywptrqrgthavvgvctadaplhsvgyqslvgsteqswgwdlgr
nklyhdskncagvtypailknflvpdkflvaldmdegtlsfivdqqylgiafrglrgkkl
ypivsavwghceitmryiggl

SCOPe Domain Coordinates for d2ihsa1:

Click to download the PDB-style file with coordinates for d2ihsa1.
(The format of our PDB-style files is described here.)

Timeline for d2ihsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ihsa2
View in 3D
Domains from other chains:
(mouse over for more information)
d2ihsb_