SCOPe 2.05: Domain d2ihna2: 2ihn A:12-180

Lineage for d2ihna2 (2ihn A:12-180)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.120: PIN domain-like [88722] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.120.1: PIN domain-like [88723] (3 families)

5. Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins)
   contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold

6. Protein T4 RNase H [53046] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [53047] (6 PDB entries)

8. Domain d2ihna2: 2ihn A:12-180 [147680]
   Other proteins in same PDB: d2ihna1
   automatically matched to d1tfra2
   protein/DNA complex

Details for d2ihna2

PDB Entry: 2ihn, 3 Å

PDB Description: co-crystal of bacteriophage t4 rnase h with a fork dna substrate

PDB Compounds: (A:) Ribonuclease H

SCOPe Domain Sequences for d2ihna2:

Sequence, based on SEQRES records:

>d2ihna2 c.120.1.2 (A:12-180) T4 RNase H {Bacteriophage T4 [TaxId: 10665]}
kegiclidfsqialstalvnfpdkekinlsmvrhlilnsikfnvkkaktlgytkivlcid
naksgywrrdfayyykknrgkareestwdwegyfesshkvidelkaympyivmdidkyea
ndhiavlvkkfsleghkiliissdgdftqlhkypnvkqwspmhkkwvki

Sequence, based on observed residues (ATOM records):

>d2ihna2 c.120.1.2 (A:12-180) T4 RNase H {Bacteriophage T4 [TaxId: 10665]}
kegiclidfsqialstalvnfpdkekinlsmvrhlilnsikfnvkkaktlgytkivlcid
naksgywrrdfayyykknrstwdwegyfesshkvidelkaympyivmdidkyeandhiav
lvkkfsleghkiliissdgdftqlhkypnvkqwspmhkkwvki

Timeline for d2ihna2:

• d2ihna2 first appeared in SCOP 1.75
  
• d2ihna2 appears in SCOPe 2.04
  
• d2ihna2 appears in SCOPe 2.06
  
• d2ihna2 appears in the current release, SCOPe 2.08