Lineage for d2ihna2 (2ihn A:12-180)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1395439Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 1395440Superfamily c.120.1: PIN domain-like [88723] (3 families) (S)
  5. 1395496Family c.120.1.2: 5' to 3' exonuclease catalytic domain [53045] (4 proteins)
    contains an alpha-helical arch and additional strand 6 antiparallel to the rest; strand order 321456; similarity to the resolvase-like fold
  6. 1395520Protein T4 RNase H [53046] (1 species)
  7. 1395521Species Bacteriophage T4 [TaxId:10665] [53047] (5 PDB entries)
  8. 1395526Domain d2ihna2: 2ihn A:12-180 [147680]
    Other proteins in same PDB: d2ihna1
    automatically matched to d1tfra2
    protein/DNA complex

Details for d2ihna2

PDB Entry: 2ihn (more details), 3 Å

PDB Description: co-crystal of bacteriophage t4 rnase h with a fork dna substrate
PDB Compounds: (A:) Ribonuclease H

SCOPe Domain Sequences for d2ihna2:

Sequence, based on SEQRES records: (download)

>d2ihna2 c.120.1.2 (A:12-180) T4 RNase H {Bacteriophage T4 [TaxId: 10665]}
kegiclidfsqialstalvnfpdkekinlsmvrhlilnsikfnvkkaktlgytkivlcid
naksgywrrdfayyykknrgkareestwdwegyfesshkvidelkaympyivmdidkyea
ndhiavlvkkfsleghkiliissdgdftqlhkypnvkqwspmhkkwvki

Sequence, based on observed residues (ATOM records): (download)

>d2ihna2 c.120.1.2 (A:12-180) T4 RNase H {Bacteriophage T4 [TaxId: 10665]}
kegiclidfsqialstalvnfpdkekinlsmvrhlilnsikfnvkkaktlgytkivlcid
naksgywrrdfayyykknrstwdwegyfesshkvidelkaympyivmdidkyeandhiav
lvkkfsleghkiliissdgdftqlhkypnvkqwspmhkkwvki

SCOPe Domain Coordinates for d2ihna2:

Click to download the PDB-style file with coordinates for d2ihna2.
(The format of our PDB-style files is described here.)

Timeline for d2ihna2: