![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.7: 5' to 3' exonuclease, C-terminal subdomain [47807] (2 families) ![]() |
![]() | Family a.60.7.1: 5' to 3' exonuclease, C-terminal subdomain [47808] (4 proteins) |
![]() | Protein T4 RNase H [47809] (1 species) |
![]() | Species Bacteriophage T4 [TaxId:10665] [47810] (5 PDB entries) |
![]() | Domain d2ihna1: 2ihn A:183-305 [147679] Other proteins in same PDB: d2ihna2 automatically matched to d1tfra1 protein/DNA complex |
PDB Entry: 2ihn (more details), 3 Å
SCOPe Domain Sequences for d2ihna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ihna1 a.60.7.1 (A:183-305) T4 RNase H {Bacteriophage T4 [TaxId: 10665]} gsaeidcmtkilkgdkkdnvasvkvrsdfwftrvegertpsmktsiveaiandreqakvl lteseynrykenlvlidfdyipdniasnivnyynsyklpprgkiysyfvkaglskltnsi nef
Timeline for d2ihna1: