SCOPe 2.08: Domain d2ih4d2: 2ih4 D:244-413

Lineage for d2ih4d2 (2ih4 D:244-413)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.287: DNA methylase specificity domain [116733] (1 superfamily)
   comprises the N-terminal, double beta-helix like structure and C-terminal alpha-hairpin

4. Superfamily d.287.1: DNA methylase specificity domain [116734] (2 families)

5. Family d.287.1.1: TaqI C-terminal domain-like [116735] (2 proteins)

6. Protein DNA methylase TaqI, C-terminal domain [116736] (1 species)

7. Species Thermus aquaticus [TaxId:271] [116737] (11 PDB entries)

8. Domain d2ih4d2: 2ih4 D:244-413 [147676]
   Other proteins in same PDB: d2ih4a1, d2ih4d1
   automatically matched to d1aqia2
   protein/DNA complex; complexed with gol, nea

Details for d2ih4d2

PDB Entry: 2ih4, 2.1 Å

PDB Description: crystal structure of the adenine-specific dna methyltransferase m.taqi complexed with the cofactor analog aeta and a 10 bp dna containing pyrrolo-dc at the target base partner position

PDB Compounds: (D:) modification methylase taqi

SCOPe Domain Sequences for d2ih4d2:

Sequence; same for both SEQRES and ATOM records:

>d2ih4d2 d.287.1.1 (D:244-413) DNA methylase TaqI, C-terminal domain {Thermus aquaticus [TaxId: 271]}
rfeteetrkleisgmplgdlfhirfaarspefkkhpavrkepgpglvpvltgrnlkpgwv
dyeknhsglwmpkerakelrdfyatphlvvahtkgtrvvaawderaypwreefhllpkeg
vrldpsslvqwlnseamqkhvrtlyrdfvphltlrmlerlpvrreygfht

Timeline for d2ih4d2:

• d2ih4d2 first appeared in SCOP 1.75
  
• d2ih4d2 appears in SCOPe 2.07