Lineage for d2ih2a2 (2ih2 A:244-413)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2615652Fold d.287: DNA methylase specificity domain [116733] (1 superfamily)
    comprises the N-terminal, double beta-helix like structure and C-terminal alpha-hairpin
  4. 2615653Superfamily d.287.1: DNA methylase specificity domain [116734] (2 families) (S)
  5. 2615654Family d.287.1.1: TaqI C-terminal domain-like [116735] (2 proteins)
  6. 2615655Protein DNA methylase TaqI, C-terminal domain [116736] (1 species)
  7. 2615656Species Thermus aquaticus [TaxId:271] [116737] (11 PDB entries)
  8. 2615657Domain d2ih2a2: 2ih2 A:244-413 [147670]
    Other proteins in same PDB: d2ih2a1, d2ih2d1
    automatically matched to d1aqia2
    protein/DNA complex; complexed with gol, nea

Details for d2ih2a2

PDB Entry: 2ih2 (more details), 1.61 Å

PDB Description: crystal structure of the adenine-specific dna methyltransferase m.taqi complexed with the cofactor analog aeta and a 10 bp dna containing 5- methylpyrimidin-2(1h)-one at the target base partner position
PDB Compounds: (A:) modification methylase taqi

SCOPe Domain Sequences for d2ih2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ih2a2 d.287.1.1 (A:244-413) DNA methylase TaqI, C-terminal domain {Thermus aquaticus [TaxId: 271]}
rfeteetrkleisgmplgdlfhirfaarspefkkhpavrkepgpglvpvltgrnlkpgwv
dyeknhsglwmpkerakelrdfyatphlvvahtkgtrvvaawderaypwreefhllpkeg
vrldpsslvqwlnseamqkhvrtlyrdfvphltlrmlerlpvrreygfht

SCOPe Domain Coordinates for d2ih2a2:

Click to download the PDB-style file with coordinates for d2ih2a2.
(The format of our PDB-style files is described here.)

Timeline for d2ih2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ih2a1