Lineage for d2igwa_ (2igw A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2806645Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2806646Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2806647Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2806997Protein automated matches [190077] (22 species)
    not a true protein
  7. 2807062Species Nematode (Caenorhabditis elegans) [TaxId:6239] [187239] (2 PDB entries)
  8. 2807064Domain d2igwa_: 2igw A: [147668]
    automated match to d1dywa_
    complexed with gly, pro

Details for d2igwa_

PDB Entry: 2igw (more details), 1.78 Å

PDB Description: cyclophilin 3 complexed with dipeptide gly-pro
PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase 3

SCOPe Domain Sequences for d2igwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2igwa_ b.62.1.1 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
msrskvffditiggkasgrivmelyddvvpktagnfralctgengigksgkplhfkgskf
hriipnfmiqggdftrgngtggesiygekfpdenfkekhtgpgvlsmanagpntngsqff
lctvktewldgkhvvfgrvvegldvvkavesngsqsgkpvkdcmiadcgqlk

SCOPe Domain Coordinates for d2igwa_:

Click to download the PDB-style file with coordinates for d2igwa_.
(The format of our PDB-style files is described here.)

Timeline for d2igwa_: