SCOPe 2.08: Domain d2igva_: 2igv A:

Lineage for d2igva_ (2igv A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein automated matches [190077] (22 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [187239] (2 PDB entries)

8. Domain d2igva_: 2igv A: [147667]
   automated match to d1dywa_
   complexed with ser

Details for d2igva_

PDB Entry: 2igv, 1.67 Å

PDB Description: cyclophilin 3 complexed with dipeptide ser-pro

PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase 3

SCOPe Domain Sequences for d2igva_:

Sequence; same for both SEQRES and ATOM records:

>d2igva_ b.62.1.1 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
msrskvffditiggkasgrivmelyddvvpktagnfralctgengigksgkplhfkgskf
hriipnfmiqggdftrgngtggesiygekfpdenfkekhtgpgvlsmanagpntngsqff
lctvktewldgkhvvfgrvvegldvvkavesngsqsgkpvkdcmiadcgqlk

Timeline for d2igva_:

• d2igva_ first appeared in SCOP 1.75, called d2igva1
  
• d2igva_ appears in SCOPe 2.07