![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
![]() | Superfamily d.2.1: Lysozyme-like [53955] (12 families) ![]() |
![]() | Family d.2.1.11: PA2222-like [159837] (2 proteins) PfamB PB104465 |
![]() | Protein automated matches [190711] (1 species) not a true protein |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [187858] (1 PDB entry) |
![]() | Domain d2igsf_: 2igs F: [147664] Other proteins in same PDB: d2igsa1 automated match to d2igsa1 complexed with acy, gol, so4 |
PDB Entry: 2igs (more details), 2.17 Å
SCOPe Domain Sequences for d2igsf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2igsf_ d.2.1.11 (F:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} aeiniyqnpgqslaniykgfarqcnpgfvfpeaqtieawdiplrlhpefipggdiskadq qystllaqeiangvtigfrmvnekervcnveilplltsmaqnldrikarfgsgyldrfkg spnvyptdvgfstdasggisqesgllvsygvnlrtltpgtwqamtlpedikalvgpgvgl rldapnfsdvfntiksglryttavtlllayfaaig
Timeline for d2igsf_: