SCOPe 2.01: Domain d2igsf_: 2igs F:

Lineage for d2igsf_ (2igs F:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.11: PA2222-like [159837] (2 proteins)
   PfamB PB104465

6. Protein automated matches [190711] (1 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [187858] (1 PDB entry)

8. Domain d2igsf_: 2igs F: [147664]
   Other proteins in same PDB: d2igsa1
   automated match to d2igsa1
   complexed with acy, gol, so4

Details for d2igsf_

PDB Entry: 2igs, 2.17 Å

PDB Description: crystal structure of the protein of unknown function from pseudomonas aeruginosa

PDB Compounds: (F:) hypothetical protein

SCOPe Domain Sequences for d2igsf_:

Sequence; same for both SEQRES and ATOM records:

>d2igsf_ d.2.1.11 (F:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
aeiniyqnpgqslaniykgfarqcnpgfvfpeaqtieawdiplrlhpefipggdiskadq
qystllaqeiangvtigfrmvnekervcnveilplltsmaqnldrikarfgsgyldrfkg
spnvyptdvgfstdasggisqesgllvsygvnlrtltpgtwqamtlpedikalvgpgvgl
rldapnfsdvfntiksglryttavtlllayfaaig

Timeline for d2igsf_:

• d2igsf_ first appeared in SCOP 1.75, called d2igsf1
  
• d2igsf_ appears in SCOPe 2.02
  
• d2igsf_ appears in the current release, SCOPe 2.08, called d2igsf2