Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
Superfamily d.2.1: Lysozyme-like [53955] (12 families) |
Family d.2.1.11: PA2222-like [159837] (2 proteins) PfamB PB104465 automatically mapped to Pfam PF11508 |
Protein automated matches [190711] (1 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:287] [187858] (1 PDB entry) |
Domain d2igsd2: 2igs D:4-215 [147662] Other proteins in same PDB: d2igsa1, d2igsa2, d2igsc3, d2igsd3, d2igse3, d2igsf3, d2igsg3, d2igsh3 automated match to d2igsa1 complexed with acy, gol, so4 |
PDB Entry: 2igs (more details), 2.17 Å
SCOPe Domain Sequences for d2igsd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2igsd2 d.2.1.11 (D:4-215) automated matches {Pseudomonas aeruginosa [TaxId: 287]} iniyqnpgqslaniykgfarqcnpgfvfpeaqtieawdiplrlhpefipggdiskadqqy stllaqeiangvtigfrmvnekervcnveilplltsmaqnldrikarfgsgyldrfkgsp nvyptdvgfstdasggisqesgllvsygvnlrtltpgtwqamtlpedikalvgpgvglrl dapnfsdvfntiksglryttavtlllayfaai
Timeline for d2igsd2: