Lineage for d2igsc2 (2igs C:4-215)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2924180Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2924181Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2926502Family d.2.1.11: PA2222-like [159837] (2 proteins)
    PfamB PB104465
    automatically mapped to Pfam PF11508
  6. 2926506Protein automated matches [190711] (1 species)
    not a true protein
  7. 2926507Species Pseudomonas aeruginosa [TaxId:287] [187858] (1 PDB entry)
  8. 2926509Domain d2igsc2: 2igs C:4-215 [147661]
    Other proteins in same PDB: d2igsa1, d2igsa2, d2igsc3, d2igsd3, d2igse3, d2igsf3, d2igsg3, d2igsh3
    automated match to d2igsa1
    complexed with acy, gol, so4

Details for d2igsc2

PDB Entry: 2igs (more details), 2.17 Å

PDB Description: crystal structure of the protein of unknown function from pseudomonas aeruginosa
PDB Compounds: (C:) hypothetical protein

SCOPe Domain Sequences for d2igsc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2igsc2 d.2.1.11 (C:4-215) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
iniyqnpgqslaniykgfarqcnpgfvfpeaqtieawdiplrlhpefipggdiskadqqy
stllaqeiangvtigfrmvnekervcnveilplltsmaqnldrikarfgsgyldrfkgsp
nvyptdvgfstdasggisqesgllvsygvnlrtltpgtwqamtlpedikalvgpgvglrl
dapnfsdvfntiksglryttavtlllayfaai

SCOPe Domain Coordinates for d2igsc2:

Click to download the PDB-style file with coordinates for d2igsc2.
(The format of our PDB-style files is described here.)

Timeline for d2igsc2: