![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.2: Lysozyme-like [53954] (1 superfamily) common alpha+beta motif for the active site region |
![]() | Superfamily d.2.1: Lysozyme-like [53955] (12 families) ![]() |
![]() | Family d.2.1.11: PA2222-like [159837] (2 proteins) PfamB PB104465 automatically mapped to Pfam PF11508 |
![]() | Protein Hypothetical protein PA2222 [159838] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [159839] (1 PDB entry) Uniprot Q9I1P7 4-215 |
![]() | Domain d2igsa1: 2igs A:4-215 [147659] Other proteins in same PDB: d2igsa2, d2igsb_, d2igsc2, d2igsc3, d2igsd2, d2igsd3, d2igse2, d2igse3, d2igsf2, d2igsf3, d2igsg2, d2igsg3, d2igsh2, d2igsh3 complexed with acy, gol, so4 |
PDB Entry: 2igs (more details), 2.17 Å
SCOPe Domain Sequences for d2igsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2igsa1 d.2.1.11 (A:4-215) Hypothetical protein PA2222 {Pseudomonas aeruginosa [TaxId: 287]} iniyqnpgqslaniykgfarqcnpgfvfpeaqtieawdiplrlhpefipggdiskadqqy stllaqeiangvtigfrmvnekervcnveilplltsmaqnldrikarfgsgyldrfkgsp nvyptdvgfstdasggisqesgllvsygvnlrtltpgtwqamtlpedikalvgpgvglrl dapnfsdvfntiksglryttavtlllayfaai
Timeline for d2igsa1: