Lineage for d2ifxb1 (2ifx B:1-107)
- Root: SCOP 1.75
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (23 families) 
dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
Family d.58.4.19: MmlI-like [160292] (1 protein)
Pfam PF09448; Methylmuconolactone methyl-isomeraseProtein Hypothetical protein Reut_A1503 [160293] (1 species) Species Ralstonia eutropha [TaxId:106590] [160294] (1 PDB entry)
Uniprot Q471R3 1-108
Domain d2ifxb1: 2ifx B:1-107 [147654]
automatically matched to 2IFX A:1-108
complexed with cl, gol
Details for d2ifxb1
PDB Entry: 2ifx (more details), 2 Å
PDB Description: crystal structure of a putative 4-methylmuconolactone methylisomerase (yp_295714.1) from ralstonia eutropha jmp134 at 2.00 a resolution
PDB Compounds: (B:) hypothetical proteinSCOP Domain Sequences for d2ifxb1:
Sequence, based on SEQRES records: (download)
>d2ifxb1 d.58.4.19 (B:1-107) Hypothetical protein Reut_A1503 {Ralstonia eutropha [TaxId: 106590]}
mirllyllvkpagmsdetfraeclrhyemshdvpglhkyevrlvaeqptdthvpffdigh
vdaigecwfkddaayatymasdirkawfehgktfigqlkpfrtapva
Sequence, based on observed residues (ATOM records): (download)
>d2ifxb1 d.58.4.19 (B:1-107) Hypothetical protein Reut_A1503 {Ralstonia eutropha [TaxId: 106590]}
mirllyllvkpagmsdetfraeclrhyemshdvpglhkyevrlvaeqphvdaigecwfkd
daayatymasdirkawfehgktfigqlkpfrtapva
SCOP Domain Coordinates for d2ifxb1:
Click to download the PDB-style file with coordinates for d2ifxb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ifxb1:
- d2ifxb1 is new in SCOP 1.75
- d2ifxb1 is called d2ifxb_ in SCOPe 2.01
- d2ifxb1 appears in the current release, SCOPe 2.08, called d2ifxb2
View in 3D
