SCOPe 2.08: Domain d2ifxb2: 2ifx B:1-107

Lineage for d2ifxb2 (2ifx B:1-107)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.19: MmlI-like [160292] (2 proteins)
   Pfam PF09448; Methylmuconolactone methyl-isomerase

6. Protein Hypothetical protein Reut_A1503 [160293] (1 species)

7. Species Ralstonia eutropha [TaxId:106590] [160294] (1 PDB entry)
   Uniprot Q471R3 1-108

8. Domain d2ifxb2: 2ifx B:1-107 [147654]
   Other proteins in same PDB: d2ifxa2, d2ifxb3
   automated match to d2ifxa1
   complexed with cl, gol

Details for d2ifxb2

PDB Entry: 2ifx, 2 Å

PDB Description: crystal structure of a putative 4-methylmuconolactone methylisomerase (yp_295714.1) from ralstonia eutropha jmp134 at 2.00 a resolution

PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d2ifxb2:

Sequence, based on SEQRES records:

>d2ifxb2 d.58.4.19 (B:1-107) Hypothetical protein Reut_A1503 {Ralstonia eutropha [TaxId: 106590]}
mirllyllvkpagmsdetfraeclrhyemshdvpglhkyevrlvaeqptdthvpffdigh
vdaigecwfkddaayatymasdirkawfehgktfigqlkpfrtapva

Sequence, based on observed residues (ATOM records):

>d2ifxb2 d.58.4.19 (B:1-107) Hypothetical protein Reut_A1503 {Ralstonia eutropha [TaxId: 106590]}
mirllyllvkpagmsdetfraeclrhyemshdvpglhkyevrlvaeqphvdaigecwfkd
daayatymasdirkawfehgktfigqlkpfrtapva

Timeline for d2ifxb2:

• d2ifxb2 first appeared in SCOP 1.75, called d2ifxb1
  
• d2ifxb2 appears in SCOPe 2.07