| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) ![]() dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
| Family d.58.4.19: MmlI-like [160292] (2 proteins) Pfam PF09448; Methylmuconolactone methyl-isomerase |
| Protein Hypothetical protein Reut_A1503 [160293] (1 species) |
| Species Ralstonia eutropha [TaxId:106590] [160294] (1 PDB entry) Uniprot Q471R3 1-108 |
| Domain d2ifxa1: 2ifx A:1-108 [147653] Other proteins in same PDB: d2ifxa2, d2ifxb3 complexed with cl, gol |
PDB Entry: 2ifx (more details), 2 Å
SCOPe Domain Sequences for d2ifxa1:
Sequence, based on SEQRES records: (download)
>d2ifxa1 d.58.4.19 (A:1-108) Hypothetical protein Reut_A1503 {Ralstonia eutropha [TaxId: 106590]}
mirllyllvkpagmsdetfraeclrhyemshdvpglhkyevrlvaeqptdthvpffdigh
vdaigecwfkddaayatymasdirkawfehgktfigqlkpfrtapvag
>d2ifxa1 d.58.4.19 (A:1-108) Hypothetical protein Reut_A1503 {Ralstonia eutropha [TaxId: 106590]}
mirllyllvkpagmsdetfraeclrhyemshdvpglhkyevrlvaeqphvpffdighvda
igecwfkddaayatymasdirkawfehgktfigqlkpfrtapvag
Timeline for d2ifxa1: