SCOPe 2.08: Domain d2ifxa1: 2ifx A:1-108

Lineage for d2ifxa1 (2ifx A:1-108)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.19: MmlI-like [160292] (2 proteins)
   Pfam PF09448; Methylmuconolactone methyl-isomerase

6. Protein Hypothetical protein Reut_A1503 [160293] (1 species)

7. Species Ralstonia eutropha [TaxId:106590] [160294] (1 PDB entry)
   Uniprot Q471R3 1-108

8. Domain d2ifxa1: 2ifx A:1-108 [147653]
   Other proteins in same PDB: d2ifxa2, d2ifxb3
   complexed with cl, gol

Details for d2ifxa1

PDB Entry: 2ifx, 2 Å

PDB Description: crystal structure of a putative 4-methylmuconolactone methylisomerase (yp_295714.1) from ralstonia eutropha jmp134 at 2.00 a resolution

PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2ifxa1:

Sequence, based on SEQRES records:

>d2ifxa1 d.58.4.19 (A:1-108) Hypothetical protein Reut_A1503 {Ralstonia eutropha [TaxId: 106590]}
mirllyllvkpagmsdetfraeclrhyemshdvpglhkyevrlvaeqptdthvpffdigh
vdaigecwfkddaayatymasdirkawfehgktfigqlkpfrtapvag

Sequence, based on observed residues (ATOM records):

>d2ifxa1 d.58.4.19 (A:1-108) Hypothetical protein Reut_A1503 {Ralstonia eutropha [TaxId: 106590]}
mirllyllvkpagmsdetfraeclrhyemshdvpglhkyevrlvaeqphvpffdighvda
igecwfkddaayatymasdirkawfehgktfigqlkpfrtapvag

Timeline for d2ifxa1:

• d2ifxa1 first appeared in SCOP 1.75
  
• d2ifxa1 appears in SCOPe 2.07