![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (23 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.21: YiiX-like [159855] (1 protein) Pfam PF06520; DUF1105; circularly permuted active site residues compare to papain |
![]() | Protein Hypothetical protein YiiX [159856] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [159857] (1 PDB entry) Uniprot Q8X778 19-200 |
![]() | Domain d2if6b_: 2if6 B: [147652] automated match to d2if6a1 complexed with unx |
PDB Entry: 2if6 (more details), 1.8 Å
SCOPe Domain Sequences for d2if6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2if6b_ d.3.1.21 (B:) Hypothetical protein YiiX {Escherichia coli [TaxId: 562]} wqpqtgdiifqisrssqskaiqlathsdyshtgmlvmrnkkpyvfeavgpvkytplkqwi ahgekgkyvvrrvegglsveqqqklaqtakrylgkpydfsfswsddrqycsevvwkvyqn algmrvgeqqklkefdlsnplvqaklkerygknipleetvvspqavfdapqlttvakewp
Timeline for d2if6b_: