Lineage for d2ielb_ (2iel B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2861263Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 2861467Family c.26.2.4: Universal stress protein-like [52436] (8 proteins)
    Pfam PF00582
  6. 2861484Protein Hypothetical protein TTC0031 [159498] (1 species)
    TT0030
  7. 2861485Species Thermus thermophilus [TaxId:274] [159499] (1 PDB entry)
    Uniprot Q72LM7 2-135
  8. 2861487Domain d2ielb_: 2iel B: [147650]
    automated match to d2iela1

Details for d2ielb_

PDB Entry: 2iel (more details), 1.6 Å

PDB Description: crystal structure of tt0030 from thermus thermophilus
PDB Compounds: (B:) Hypothetical Protein TT0030

SCOPe Domain Sequences for d2ielb_:

Sequence, based on SEQRES records: (download)

>d2ielb_ c.26.2.4 (B:) Hypothetical protein TTC0031 {Thermus thermophilus [TaxId: 274]}
rylvvahrtakspelaaklkellaqdpearfvllvpavpppgwvyeenevrrraeeeaaa
akraleaqgipveeakagdispllaieeellahpgayqgivlstlppglsrwlrldvhtq
aerfglpvihviaq

Sequence, based on observed residues (ATOM records): (download)

>d2ielb_ c.26.2.4 (B:) Hypothetical protein TTC0031 {Thermus thermophilus [TaxId: 274]}
rylvvahrtakspelaaklkelarfvllvpavpppgwvyenevrrraeeeaaaakralea
qgipveeakagdispllaieeellahpgayqgivlstlppglsrwlrldvhtqaerfglp
vihviaq

SCOPe Domain Coordinates for d2ielb_:

Click to download the PDB-style file with coordinates for d2ielb_.
(The format of our PDB-style files is described here.)

Timeline for d2ielb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2iela1