| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family) ![]() |
| Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (34 proteins) |
| Protein Transcriptional regulator TM1030 [140877] (1 species) |
| Species Thermotoga maritima [TaxId:2336] [140878] (4 PDB entries) Uniprot Q9X0C0 76-200 |
| Domain d2ieka2: 2iek A:76-200 [147648] Other proteins in same PDB: d2ieka1 automatically matched to d1z77a2 complexed with p2k |
PDB Entry: 2iek (more details), 1.83 Å
SCOP Domain Sequences for d2ieka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ieka2 a.121.1.1 (A:76-200) Transcriptional regulator TM1030 {Thermotoga maritima [TaxId: 2336]}
rdifdfmerwiekkleysashpeeadflitlvsvdeglrkrilldleksqrvffdfvrek
lkdldlaedvteeialkflmwffsgfeevylrtyqgkpellkrdmntlveevkvmlrilk
kgmtk
Timeline for d2ieka2: