SCOPe 2.01: Domain d2ieka1: 2iek A:2-75

Lineage for d2ieka1 (2iek A:2-75)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (34 proteins)

6. Protein Transcriptional regulator TM1030 [140209] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [140210] (4 PDB entries)
   Uniprot Q9X0C0 1-75! Uniprot Q9X0C0 2-75

8. Domain d2ieka1: 2iek A:2-75 [147647]
   Other proteins in same PDB: d2ieka2
   automatically matched to d1z77a1
   complexed with p6g

Details for d2ieka1

PDB Entry: 2iek, 1.83 Å

PDB Description: new crystal form of transcriptional regulator tm1030 from thermotoga maritima

PDB Compounds: (A:) TRANSCRIPTIONAL REGULATOR, TetR FAMILY

SCOPe Domain Sequences for d2ieka1:

Sequence; same for both SEQRES and ATOM records:

>d2ieka1 a.4.1.9 (A:2-75) Transcriptional regulator TM1030 {Thermotoga maritima [TaxId: 2336]}
lskrdailkaavevfgkkgydrattdeiaekagvakglifhyfknkeelyyqaymsvtek
lqkefenflmknrn

Timeline for d2ieka1:

• d2ieka1 first appeared in SCOP 1.75
  
• d2ieka1 appears in SCOPe 2.02
  
• d2ieka1 appears in the current release, SCOPe 2.08