Lineage for d2iedb_ (2ied B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2102904Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 2103489Protein Enoyl-ACP reductase [51791] (11 species)
  7. 2103608Species Mycobacterium tuberculosis, TB, gene InhA [TaxId:1773] [51793] (70 PDB entries)
  8. 2103647Domain d2iedb_: 2ied B: [147644]
    automated match to d1bvra_
    mutant

Details for d2iedb_

PDB Entry: 2ied (more details), 2.14 Å

PDB Description: crystal structure of isoniazid-resistant s94a enoyl-acp(coa) reductase mutant enzyme from mycobacterium tuberculosis uncomplexed
PDB Compounds: (B:) Enoyl-[acyl-carrier-protein] reductase [NADH]

SCOPe Domain Sequences for d2iedb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iedb_ c.2.1.2 (B:) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]}
tglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll
eldvqneehlaslagrvteaigagnkldgvvhaigfmpqtgmginpffdapyadvskgih
isaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagk
ygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvakt
vcallsdwlpattgdiiyadggahtqll

SCOPe Domain Coordinates for d2iedb_:

Click to download the PDB-style file with coordinates for d2iedb_.
(The format of our PDB-style files is described here.)

Timeline for d2iedb_: