Lineage for d2idya1 (2idy A:1-112)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2935233Superfamily d.15.14: NSP3A-like [159936] (1 family) (S)
    short helical inserions in the common fold
  5. 2935234Family d.15.14.1: NSP3A-like [159937] (1 protein)
  6. 2935235Protein Nsp3 [159938] (1 species)
  7. 2935236Species SARS coronavirus [TaxId:227859] [159939] (2 PDB entries)
    Uniprot P59641 819-930
  8. 2935238Domain d2idya1: 2idy A:1-112 [147640]

Details for d2idya1

PDB Entry: 2idy (more details)

PDB Description: nmr structure of the sars-cov non-structural protein nsp3a
PDB Compounds: (A:) nsp3

SCOPe Domain Sequences for d2idya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2idya1 d.15.14.1 (A:1-112) Nsp3 {SARS coronavirus [TaxId: 227859]}
apikgvtfgedtvwevqgyknvritfeldervdkvlnekcsvytvesgtevtefacvvae
avvktlqpvsdlltnmgidldewsvatfylfddageenfssrmycsfyppde

SCOPe Domain Coordinates for d2idya1:

Click to download the PDB-style file with coordinates for d2idya1.
(The format of our PDB-style files is described here.)

Timeline for d2idya1: