![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.64: eIF1-like [55158] (2 superfamilies) beta(2)-alpha-beta(2)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet: order 51243 |
![]() | Superfamily d.64.2: TM1457-like [118010] (1 family) ![]() forms a homodimer via alpha-helical interface automatically mapped to Pfam PF04327 |
![]() | Family d.64.2.1: TM1457-like [118011] (5 proteins) Pfam PF04327; DUF464 |
![]() | Protein automated matches [190707] (1 species) not a true protein |
![]() | Species Streptococcus pneumoniae [TaxId:170187] [187853] (1 PDB entry) |
![]() | Domain d2idlb2: 2idl B:1-113 [147639] Other proteins in same PDB: d2idla1, d2idla2, d2idlb3 automated match to d2idla1 complexed with gol, na |
PDB Entry: 2idl (more details), 1.7 Å
SCOPe Domain Sequences for d2idlb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2idlb2 d.64.2.1 (B:1-113) automated matches {Streptococcus pneumoniae [TaxId: 170187]} miqavferaedgelrsaeitghaesgeygldvvcasvstlainfinsiekfagyepilel nedeggylmveipkdlpshqremtqlffesfflgmanlsenysefvqtrvite
Timeline for d2idlb2: