SCOPe 2.06: Domain d2idlb2: 2idl B:1-113

Lineage for d2idlb2 (2idl B:1-113)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.64: eIF1-like [55158] (2 superfamilies)
   beta(2)-alpha-beta(2)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet: order 51243

4. Superfamily d.64.2: TM1457-like [118010] (1 family)
   forms a homodimer via alpha-helical interface
   automatically mapped to Pfam PF04327

5. Family d.64.2.1: TM1457-like [118011] (5 proteins)
   Pfam PF04327; DUF464

6. Protein automated matches [190707] (1 species)
   not a true protein

7. Species Streptococcus pneumoniae [TaxId:170187] [187853] (1 PDB entry)

8. Domain d2idlb2: 2idl B:1-113 [147639]
   Other proteins in same PDB: d2idla1, d2idla2, d2idlb3
   automated match to d2idla1
   complexed with gol, na

Details for d2idlb2

PDB Entry: 2idl, 1.7 Å

PDB Description: Crystal Structure of Conserved Protein of Unknown Function from Streptococcus pneumoniae

PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d2idlb2:

Sequence; same for both SEQRES and ATOM records:

>d2idlb2 d.64.2.1 (B:1-113) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
miqavferaedgelrsaeitghaesgeygldvvcasvstlainfinsiekfagyepilel
nedeggylmveipkdlpshqremtqlffesfflgmanlsenysefvqtrvite

Timeline for d2idlb2:

• d2idlb2 first appeared in SCOP 1.75, called d2idlb1
  
• d2idlb2 was called d2idlb_ in SCOPe 2.05
  
• d2idlb2 appears in SCOPe 2.07
  
• d2idlb2 appears in the current release, SCOPe 2.08