Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.64: eIF1-like [55158] (2 superfamilies) beta(2)-alpha-beta(2)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet: order 51243 |
Superfamily d.64.2: TM1457-like [118010] (1 family) forms a homodimer via alpha-helical interface automatically mapped to Pfam PF04327 |
Family d.64.2.1: TM1457-like [118011] (5 proteins) Pfam PF04327; DUF464 |
Protein Hypothetical protein SP1106 [160432] (1 species) |
Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [160433] (1 PDB entry) Uniprot Q97QU3 1-112 |
Domain d2idla1: 2idl A:1-112 [147638] Other proteins in same PDB: d2idla2, d2idlb2, d2idlb3 complexed with gol, na |
PDB Entry: 2idl (more details), 1.7 Å
SCOPe Domain Sequences for d2idla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2idla1 d.64.2.1 (A:1-112) Hypothetical protein SP1106 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} miqavferaedgelrsaeitghaesgeygldvvcasvstlainfinsiekfagyepilel nedeggylmveipkdlpshqremtqlffesfflgmanlsenysefvqtrvit
Timeline for d2idla1: