SCOPe 2.07: Domain d2idla1: 2idl A:1-112

Lineage for d2idla1 (2idl A:1-112)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.64: eIF1-like [55158] (2 superfamilies)
   beta(2)-alpha-beta(2)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet: order 51243

4. Superfamily d.64.2: TM1457-like [118010] (1 family)
   forms a homodimer via alpha-helical interface
   automatically mapped to Pfam PF04327

5. Family d.64.2.1: TM1457-like [118011] (5 proteins)
   Pfam PF04327; DUF464

6. Protein Hypothetical protein SP1106 [160432] (1 species)

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [160433] (1 PDB entry)
   Uniprot Q97QU3 1-112

8. Domain d2idla1: 2idl A:1-112 [147638]
   Other proteins in same PDB: d2idla2, d2idlb2, d2idlb3
   complexed with gol, na

Details for d2idla1

PDB Entry: 2idl, 1.7 Å

PDB Description: Crystal Structure of Conserved Protein of Unknown Function from Streptococcus pneumoniae

PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2idla1:

Sequence; same for both SEQRES and ATOM records:

>d2idla1 d.64.2.1 (A:1-112) Hypothetical protein SP1106 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
miqavferaedgelrsaeitghaesgeygldvvcasvstlainfinsiekfagyepilel
nedeggylmveipkdlpshqremtqlffesfflgmanlsenysefvqtrvit

Timeline for d2idla1:

• d2idla1 first appeared in SCOP 1.75
  
• d2idla1 appears in SCOPe 2.06
  
• d2idla1 appears in the current release, SCOPe 2.08