SCOPe 2.08: Domain d2idhh2: 2idh H:253-284

Lineage for d2idhh2 (2idh H:253-284)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.72: WW domain-like [51044] (3 superfamilies)
   core: 3-stranded meander beta-sheet

4. Superfamily b.72.1: WW domain [51045] (2 families)

5. Family b.72.1.1: WW domain [51046] (13 proteins)

6. Protein Amyloid beta A4 precursor protein-binding family B member 1, APBB1 [159267] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159268] (4 PDB entries)
   Uniprot O00213 241-290! Uniprot O00213 253-285

8. Domain d2idhh2: 2idh H:253-284 [147637]
   Other proteins in same PDB: d2idhd3, d2idhh3
   automated match to d2ho2a1
   complexed with pg4, so4

Details for d2idhh2

PDB Entry: 2idh, 2.28 Å

PDB Description: Crystal Structure of human FE65 WW domain

PDB Compounds: (H:) Amyloid beta A4 protein-binding family B member 1

SCOPe Domain Sequences for d2idhh2:

Sequence; same for both SEQRES and ATOM records:

>d2idhh2 b.72.1.1 (H:253-284) Amyloid beta A4 precursor protein-binding family B member 1, APBB1 {Human (Homo sapiens) [TaxId: 9606]}
sdlpagwmrvqdtsgtyywhiptgttqweppg

Timeline for d2idhh2:

• d2idhh2 first appeared in SCOP 1.75, called d2idhh1
  
• d2idhh2 appears in SCOPe 2.07