Lineage for d2idhd2 (2idh D:253-285)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2420693Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 2420694Superfamily b.72.1: WW domain [51045] (2 families) (S)
  5. 2420695Family b.72.1.1: WW domain [51046] (13 proteins)
  6. 2420696Protein Amyloid beta A4 precursor protein-binding family B member 1, APBB1 [159267] (1 species)
  7. 2420697Species Human (Homo sapiens) [TaxId:9606] [159268] (4 PDB entries)
    Uniprot O00213 241-290! Uniprot O00213 253-285
  8. 2420703Domain d2idhd2: 2idh D:253-285 [147633]
    Other proteins in same PDB: d2idhd3, d2idhh3
    automated match to d2ho2a1
    complexed with pg4, so4

Details for d2idhd2

PDB Entry: 2idh (more details), 2.28 Å

PDB Description: Crystal Structure of human FE65 WW domain
PDB Compounds: (D:) Amyloid beta A4 protein-binding family B member 1

SCOPe Domain Sequences for d2idhd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2idhd2 b.72.1.1 (D:253-285) Amyloid beta A4 precursor protein-binding family B member 1, APBB1 {Human (Homo sapiens) [TaxId: 9606]}
sdlpagwmrvqdtsgtyywhiptgttqweppgr

SCOPe Domain Coordinates for d2idhd2:

Click to download the PDB-style file with coordinates for d2idhd2.
(The format of our PDB-style files is described here.)

Timeline for d2idhd2: