Lineage for d2idhd_ (2idh D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1804793Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 1804794Superfamily b.72.1: WW domain [51045] (2 families) (S)
  5. 1804795Family b.72.1.1: WW domain [51046] (13 proteins)
  6. 1804796Protein Amyloid beta A4 precursor protein-binding family B member 1, APBB1 [159267] (1 species)
  7. 1804797Species Human (Homo sapiens) [TaxId:9606] [159268] (4 PDB entries)
    Uniprot O00213 241-290! Uniprot O00213 253-285
  8. 1804803Domain d2idhd_: 2idh D: [147633]
    automated match to d2ho2a1
    complexed with pg4, so4

Details for d2idhd_

PDB Entry: 2idh (more details), 2.28 Å

PDB Description: Crystal Structure of human FE65 WW domain
PDB Compounds: (D:) Amyloid beta A4 protein-binding family B member 1

SCOPe Domain Sequences for d2idhd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2idhd_ b.72.1.1 (D:) Amyloid beta A4 precursor protein-binding family B member 1, APBB1 {Human (Homo sapiens) [TaxId: 9606]}
gsdlpagwmrvqdtsgtyywhiptgttqweppgr

SCOPe Domain Coordinates for d2idhd_:

Click to download the PDB-style file with coordinates for d2idhd_.
(The format of our PDB-style files is described here.)

Timeline for d2idhd_: