Lineage for d2idhd1 (2idh D:253-285)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1136466Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 1136467Superfamily b.72.1: WW domain [51045] (1 family) (S)
  5. 1136468Family b.72.1.1: WW domain [51046] (13 proteins)
  6. 1136469Protein Amyloid beta A4 precursor protein-binding family B member 1, APBB1 [159267] (1 species)
  7. 1136470Species Human (Homo sapiens) [TaxId:9606] [159268] (4 PDB entries)
    Uniprot O00213 241-290! Uniprot O00213 253-285
  8. 1136476Domain d2idhd1: 2idh D:253-285 [147633]
    automatically matched to 2HO2 A:253-285
    complexed with pg4, so4

Details for d2idhd1

PDB Entry: 2idh (more details), 2.28 Å

PDB Description: Crystal Structure of human FE65 WW domain
PDB Compounds: (D:) Amyloid beta A4 protein-binding family B member 1

SCOPe Domain Sequences for d2idhd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2idhd1 b.72.1.1 (D:253-285) Amyloid beta A4 precursor protein-binding family B member 1, APBB1 {Human (Homo sapiens) [TaxId: 9606]}
sdlpagwmrvqdtsgtyywhiptgttqweppgr

SCOPe Domain Coordinates for d2idhd1:

Click to download the PDB-style file with coordinates for d2idhd1.
(The format of our PDB-style files is described here.)

Timeline for d2idhd1: