Lineage for d2idgc2 (2idg C:1-164)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2349135Fold a.184: TorD-like [89154] (1 superfamily)
    multihelical; bundle
  4. 2349136Superfamily a.184.1: TorD-like [89155] (1 family) (S)
  5. 2349137Family a.184.1.1: TorD-like [89156] (5 proteins)
    Pfam PF06192
  6. 2349138Protein Hypothetical protein AF0160 [158817] (1 species)
  7. 2349139Species Archaeoglobus fulgidus [TaxId:2234] [158818] (1 PDB entry)
    Uniprot O30077 1-160
  8. 2349142Domain d2idgc2: 2idg C:1-164 [147629]
    Other proteins in same PDB: d2idgb3, d2idgc3
    automated match to d2idga1

Details for d2idgc2

PDB Entry: 2idg (more details), 2.69 Å

PDB Description: crystal structure of hypothetical protein af0160 from archaeoglobus fulgidus
PDB Compounds: (C:) Hypothetical protein AF0160

SCOPe Domain Sequences for d2idgc2:

Sequence, based on SEQRES records: (download)

>d2idgc2 a.184.1.1 (C:1-164) Hypothetical protein AF0160 {Archaeoglobus fulgidus [TaxId: 2234]}
mtigrakvyatlskifyhlfydeaipkdcreiiekfgeidfnlrsvlvrelrgsvlikdm
pqslaevyesvmkdfyerygfqaselhadhiavelafmsklvereislaqqmkeeelyki
raaqhrfikahlqplvknlpsapllnfvrdfvredakylysslv

Sequence, based on observed residues (ATOM records): (download)

>d2idgc2 a.184.1.1 (C:1-164) Hypothetical protein AF0160 {Archaeoglobus fulgidus [TaxId: 2234]}
mtigrakvyatlskifyhlfydeaipkdcreiiekfgeidfnlrsvlvrelrgsvlikdm
pqslaevyesvmkdfyerygfqaselhadhiavelafmsklvereislaqmkeeelykir
aaqhrfikahlqplvknlpsapllnfvrdfvredakylysslv

SCOPe Domain Coordinates for d2idgc2:

Click to download the PDB-style file with coordinates for d2idgc2.
(The format of our PDB-style files is described here.)

Timeline for d2idgc2: