SCOPe 2.08: Domain d2idgc2: 2idg C:1-164

Lineage for d2idgc2 (2idg C:1-164)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.184: TorD-like [89154] (1 superfamily)
   multihelical; bundle

4. Superfamily a.184.1: TorD-like [89155] (1 family)

5. Family a.184.1.1: TorD-like [89156] (5 proteins)
   Pfam PF06192

6. Protein Hypothetical protein AF0160 [158817] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [158818] (1 PDB entry)
   Uniprot O30077 1-160

8. Domain d2idgc2: 2idg C:1-164 [147629]
   Other proteins in same PDB: d2idgb3, d2idgc3
   automated match to d2idga1

Details for d2idgc2

PDB Entry: 2idg, 2.69 Å

PDB Description: crystal structure of hypothetical protein af0160 from archaeoglobus fulgidus

PDB Compounds: (C:) Hypothetical protein AF0160

SCOPe Domain Sequences for d2idgc2:

Sequence, based on SEQRES records:

>d2idgc2 a.184.1.1 (C:1-164) Hypothetical protein AF0160 {Archaeoglobus fulgidus [TaxId: 2234]}
mtigrakvyatlskifyhlfydeaipkdcreiiekfgeidfnlrsvlvrelrgsvlikdm
pqslaevyesvmkdfyerygfqaselhadhiavelafmsklvereislaqqmkeeelyki
raaqhrfikahlqplvknlpsapllnfvrdfvredakylysslv

Sequence, based on observed residues (ATOM records):

>d2idgc2 a.184.1.1 (C:1-164) Hypothetical protein AF0160 {Archaeoglobus fulgidus [TaxId: 2234]}
mtigrakvyatlskifyhlfydeaipkdcreiiekfgeidfnlrsvlvrelrgsvlikdm
pqslaevyesvmkdfyerygfqaselhadhiavelafmsklvereislaqmkeeelykir
aaqhrfikahlqplvknlpsapllnfvrdfvredakylysslv

Timeline for d2idgc2:

• d2idgc2 first appeared in SCOP 1.75, called d2idgc1
  
• d2idgc2 appears in SCOPe 2.07