| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.184: TorD-like [89154] (1 superfamily) multihelical; bundle |
Superfamily a.184.1: TorD-like [89155] (1 family) ![]() |
| Family a.184.1.1: TorD-like [89156] (5 proteins) Pfam PF06192 |
| Protein Hypothetical protein AF0160 [158817] (1 species) |
| Species Archaeoglobus fulgidus [TaxId:2234] [158818] (1 PDB entry) Uniprot O30077 1-160 |
| Domain d2idgb2: 2idg B:1-162 [147628] Other proteins in same PDB: d2idgb3, d2idgc3 automated match to d2idga1 |
PDB Entry: 2idg (more details), 2.69 Å
SCOPe Domain Sequences for d2idgb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2idgb2 a.184.1.1 (B:1-162) Hypothetical protein AF0160 {Archaeoglobus fulgidus [TaxId: 2234]}
mtigrakvyatlskifyhlfydeaipkdcreiiekfgeidfnlrsvlvrelrgsvlikdm
pqslaevyesvmkdfyerygfqaselhadhiavelafmsklvereislaqqmkeeelyki
raaqhrfikahlqplvknlpsapllnfvrdfvredakylyss
Timeline for d2idgb2: